PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G177900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 390aa    MW: 44611.7 Da    PI: 5.5951
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G177900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-16165211148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT eEd ll+++v+q+G + W+ Ia+ ++  R +kqc++rw+++l
  Phvul.009G177900.1 165 KGHWTIEEDGLLIQLVEQYGLRKWSHIAKILP-ERIGKQCRERWHNHL 211
                         789*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.445160215IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-22164214IPR009057Homeodomain-like
SMARTSM007171.0E-13164213IPR001005SANT/Myb domain
SuperFamilySSF466891.86E-18165219IPR009057Homeodomain-like
PfamPF139214.6E-15168217No hitNo description
CDDcd001673.23E-14168211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MNIEKLVKES FVSQLLQESC MKDMIPLGNP SSHELLQQHF HNIDEFQFSV PSSNNSTFHA  60
LHNFTFTPSS PDLDVYECKP FTHVMDNFLY GDSQRNIELD IMVSNQSFLP FTPQQIKPSN  120
FALPDEVSCI SPMNYYKGIG VNKSHRSYPT TRRTYKVHKK SNTVKGHWTI EEDGLLIQLV  180
EQYGLRKWSH IAKILPERIG KQCRERWHNH LRPDIKYPRG TLLQEYIKSL NLDKNPPRDY  240
RRKSCANYAT PMNIKTSTSK ATAPALPQTV FQFCATECLA PNSDFNVVPD FLFGENLFEE  300
GCCIDSLLDG VSCVPLENTK IFEGKLQFDG MMEGIKYCDY GGIEGVAGVN MDENDVERDM  360
ALEMLEVQVK KELDLVEMIS QINNETFYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-18164216355C-Myb DNA-Binding Domain
1msf_C2e-18164216355C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138059.10.0hypothetical protein PHAVU_009G177100g
TrEMBLV7AZJ90.0V7AZJ9_PHAVU; Uncharacterized protein
STRINGGLYMA06G19280.21e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-35myb domain protein 98